Product price, shipping and contact information
Currently unavailable
Sorry, we can't display this right now.
Please contact us to place your order, or try again later.
Loading size & price…
Shipping and order information
Abpromise
Guaranteed product quality, expert customer support.
Find out more.
Description
-
Product name
Recombinant human Growth hormone receptor protein (Fc Chimera Active)
See all Growth hormone receptor proteins and peptides -
Biological activity
Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells in the presence of 0.2 ng/mL of rhGH. The ED50 for this effect is typically 0.8 - 3.5 ng/ml.
-
Purity
> 95 % SDS-PAGE.
-
Endotoxin level
< 1.000Eu/µg
-
Expression system
HEK 293 cells
-
Accession
-
Protein length
Protein fragment
-
Animal free
No
-
Nature
Recombinant
-
-
Species
Human
-
Sequence
AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGT KNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYC IKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWE APRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEY EVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
-
Predicted molecular weight
54 kDa including tags
-
Molecular weight information
As a result of glycosylation, the protein migrates as 66-85 kDa under reducing (R) condition, and 135-160 kDa under non-reducing (NR) condition (SDS-PAGE).
-
Amino acids
27 to 264
-
Additional sequence information
Growth hormone receptor Fc Chimera, fused with Fc fragment of Human IgG1 at the C terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab180056 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.40
Constituents: 10% Trehalose, 90% PBSLyophilized from 0.22 µm filtered solution.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
Reconstitution
Lot Specific - Contact Technical Support
General Info
-
Alternative names
- GH receptor
- GH-binding protein
- GHBP
see all
-
Function
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway.
The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
Isoform 2 up-regulates the production of GHBP and acts as a negative inhibitor of GH signaling. -
Tissue specificity
Expressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is highly expressed in placental villi. Isoform 2 is expressed in lung, stomach and muscle. Low levels in liver.
-
Involvement in disease
Defects in GHR are a cause of Laron syndrome (LARS) [MIM:262500]. A severe form of growth hormone insensitivity characterized by growth impairment, short stature, dysfunctional growth hormone receptor, and failure to generate insulin-like growth factor I in response to growth hormone.
Defects in GHR may be a cause of idiopathic short stature autosomal (ISSA) [MIM:604271]. Short stature is defined by a subnormal rate of growth. -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 1 subfamily.
Contains 1 fibronectin type-III domain. -
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
The extracellular domain is the ligand-binding domain representing the growth hormone-binding protein (GHBP).
The ubiquitination-dependent endocytosis motif (UbE) is required for recruitment of the ubiquitin conjugation system on to the receptor and for its internalization. -
Post-translational
modificationsThe soluble form (GHBP) is produced by phorbol ester-promoted proteolytic cleavage at the cell surface (shedding) by ADAM17/TACE. Shedding is inhibited by growth hormone (GH) binding to the receptor probably due to a conformational change in GHR rendering the receptor inaccessible to ADAM17.
On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2.
On ligand binding, ubiquitinated on lysine residues in the cytoplasmic domain. This ubiquitination is not sufficient for GHR internalization. -
Cellular localization
Secreted; Cell membrane. On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway and Cell membrane. Remains fixed to the cell membrane and is not internalized.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant human Growth hormone receptor protein (Fc Chimera Active) (ab180056)
Human GHR, Fc Tag on SDS-PAGE under reducing (R) and non-reducing (NR) conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Functional Studies - Recombinant human Growth hormone receptor protein (Fc Chimera Active) (ab180056)
Immobilized Human GH, Tag Free at 2µg/mL (100 µL/well) can bind Human GHR, Fc Tag with a linear range of 0.19-3.1 ng/mL.
-
SDS-PAGE - Recombinant human Growth hormone receptor protein (Fc Chimera Active) (ab180056)
SDS-PAGE analysis of ab180056in reducing (lane 1) and non-reducing (lane 2) conditions. Gel stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 66-85 kDa and non-reduced protein migrates as 135-160 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Click here to view the general protocols
Datasheets and documents
-
Datasheet download
Download
References (0)
Publishing research using ab180056? Please let us know so that we can cite the reference in this datasheet.
ab180056 has not yet been referenced specifically in any publications.